Showing 1 - 2 results out of 2 with the query:
AB_10602216
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-DENND2A antibody produced in rabbit
DENND2A antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA026718, RRID:AB_10602216)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA026718
Anti-DENND2A polyclonal antibody
DENND2A epitope: KKLEQALKDGSAGLDPQLPGTCYSPHCPPDKAEAGSTLPENLGGGSGSEVSQRVHPSDLEGREPTPELVEDRKGSCRRPWDRSLENVYRGSEGSPTKPFINP See NCBI gene human
(Atlas Antibodies Cat# HPA026718, RRID:AB_10602216)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KKLEQALKDGSAGLDPQLPGTCYSPHCPPDKAEAGSTLPENLGGGSGSEVSQRVHPSDLEGREPTPELVEDRKGSCRRPWDRSLENVYRGSEGSPTKPFINP; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies Go To Vendor
HPA026718