Showing 1 - 2 results out of 2 with the query:
AB_10602702
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-C6orf170 antibody produced in rabbit
C6orf170 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA013413, RRID:AB_10602702)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA013413
Anti-TBC1D32 polyclonal antibody
TBC1D32 epitope: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE See NCBI gene human
(Atlas Antibodies Cat# HPA013413, RRID:AB_10602702)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA013413