Showing 1 - 2 results out of 2 with the query:
AB_10603339
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SNX9 antibody produced in rabbit
SNX9 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA031410, RRID:AB_10603339)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA031410
Anti-SNX9 polyclonal antibody
SNX9 epitope: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA031410, RRID:AB_10603339)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA031410