Showing 1 - 2 results out of 2 with the query:
AB_10603451
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-C1orf158 antibody produced in rabbit
C1orf158 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA028396, RRID:AB_10603451)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA028396
Anti-C1orf158 polyclonal antibody Go To Vendor
C1orf158 epitope: VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQ See NCBI gene human
(Atlas Antibodies Cat# HPA028396, RRID:AB_10603451)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQ; Manufacturer approved use: IHC
rabbit
Atlas Antibodies
HPA028396