Showing 1 - 2 results out of 2 with the query:
AB_10603780
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-C9orf150 antibody produced in rabbit
C9orf150 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA024407, RRID:AB_10603780)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA024407
Anti-LURAP1L antibody
LURAP1L epitope: KVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGCSSSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKW See NCBI gene human
(Atlas Antibodies Cat# HPA024407, RRID:AB_10603780)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA024407