Showing 1 - 2 results out of 2 with the query:
AB_10603893
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-STAT5A antibody produced in rabbit
STAT5A antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA027873, RRID:AB_10603893)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA027873
Anti-STAT5A polyclonal antibody Go To Vendor
STAT5A epitope: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA027873, RRID:AB_10603893)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA027873