Showing 1 - 2 results out of 2 with the query:
AB_10604096
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SNRNP200 antibody produced in rabbit
SNRNP200 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA029321, RRID:AB_10604096)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA029321
Anti-SNRNP200 polyclonal antibody Go To Vendor
SNRNP200 epitope: LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA029321, RRID:AB_10604096)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA029321