Showing 1 - 2 results out of 2 with the query:
AB_10611533
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ZC3H11A antibody produced in rabbit
ZC3H11A antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA028526, RRID:AB_10611533)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA028526
Anti-ZBED6 antibody Go To Vendor
ZBED6 epitope: ETMREKHMQKQQEREKSVLTPLRGDVASCNTQVAEKPVLTAVPGITRHLTKRLPTKSSQKVEVETSGIGDSLLNVKCAAQTLEKRGKAKPKVNVKPSVVKVV See NCBI gene human
(Atlas Antibodies Cat# HPA028526, RRID:AB_10611533)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA028526