Showing 1 - 2 results out of 2 with the query:
AB_10672223
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-NOP16 antibody produced in rabbit
NOP16 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA036506, RRID:AB_10672223)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA036506
Anti-NOP16 antibody Go To Vendor
NOP16 epitope: LRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMAR See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA036506, RRID:AB_10672223)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA036506