Showing 1 - 2 results out of 2 with the query:
AB_10672589
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-DHX29 antibody produced in rabbit
DHX29 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038318, RRID:AB_10672589)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA038318
Anti-DHX29 polyclonal antibody Go To Vendor
DHX29 epitope: EEEEEVTINVTSKAGGIKKYQEYIPVQTGAHADLNPFYQKYSSRTQHAILYMNPHKINLDLILELLAYLDKSPQFRNIEGAV See NCBI gene human, mouse
(Atlas Antibodies Cat# HPA038318, RRID:AB_10672589)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038318