Showing 1 - 2 results out of 2 with the query:
AB_10672598
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-U2SURP antibody produced in rabbit
U2SURP antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA037545, RRID:AB_10672598)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA037545
Anti-U2SURP polyclonal antibody Go To Vendor
U2SURP epitope: EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA037545, RRID:AB_10672598)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA037545