Showing 1 - 2 results out of 2 with the query:
AB_10673478
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-HSPA5 antibody produced in rabbit
HSPA5 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038846, RRID:AB_10673478)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA038846
Anti-HSPA5 antibody Go To Vendor
HSPA5 epitope: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA038846, RRID:AB_10673478)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038846