Showing 1 - 2 results out of 2 with the query:
AB_10675794
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-CALCOCO1 antibody produced in rabbit
CALCOCO1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038313, RRID:AB_10675794)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA038313
Anti-CALCOCO1 antibody Go To Vendor
CALCOCO1 epitope: EHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHL See NCBI gene human
(Atlas Antibodies Cat# HPA038313, RRID:AB_10675794)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038313