Showing 1 - 2 results out of 2 with the query:
AB_10697090
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TRPC3 antibody produced in rabbit
TRPC3 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA037969, RRID:AB_10697090)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA037969
Anti-TRPC3 polyclonal antibody Go To Vendor
TRPC3 epitope: NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI See NCBI gene human
(Atlas Antibodies Cat# HPA037969, RRID:AB_10697090)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies
HPA037969