Showing 1 - 3 results out of 3 with the query:
AB_1078088
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ACAT1 antibody produced in rabbit
Human ACAT1 human
(Sigma-Aldrich Cat# HPA004428, RRID:AB_1078088)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA004428
Anti-ACAT1 antibody Go To Vendor
ACAT1 epitope: VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA004428, RRID:AB_1078088)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004428
Anti-ACAT1 antibody produced in rabbit
ACAT1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004428, RRID:AB_1078088)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot
rabbit
Sigma-Aldrich
HPA004428