Showing 1 - 3 results out of 3 with the query:
AB_1078234
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ATF7-human antibody
ATF7 homo sapiens
(Sigma-Aldrich Cat# HPA003384, RRID:AB_1078234)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R04563 for HepG2,K562,GM12878,HEK293T,HeLa-S3,MCF-7,liver; status is not eligible for new data,awaiting lab characterization,pending dcc review
rabbit
Sigma-Aldrich Go To Vendor
HPA003384
Anti-ATF7 antibody produced in rabbit
ATF7 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003384, RRID:AB_1078234)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA003384
Anti-ATF7 polyclonal antibody
ATF7 epitope: LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE See NCBI gene human
(Atlas Antibodies Cat# HPA003384, RRID:AB_1078234)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA003384