Showing 1 - 3 results out of 3 with the query:
AB_1078267
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GPANK1 antibody produced in rabbit
Human BAT4 human
(Sigma-Aldrich Cat# HPA006301, RRID:AB_1078267)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006301
Anti-GPANK1 polyclonal antibody
GPANK1 epitope: GVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQ See NCBI gene human
(Atlas Antibodies Cat# HPA006301, RRID:AB_1078267)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA006301
Anti-GPANK1 antibody produced in rabbit
GPANK1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006301, RRID:AB_1078267)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA006301