Showing 1 - 3 results out of 3 with the query:
AB_1078325
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-INF2 antibody produced in rabbit
Human C14orf151 human
(Sigma-Aldrich Cat# HPA000724, RRID:AB_1078325)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA000724
Anti-INF2 antibody produced in rabbit
INF2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000724, RRID:AB_1078325)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA000724
Anti-INF2 polyclonal antibody Go To Vendor
INF2 epitope: GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR See NCBI gene human
(Atlas Antibodies Cat# HPA000724, RRID:AB_1078325)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA000724