Showing 1 - 3 results out of 3 with the query:
AB_1078355
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-C4BPA antibody produced in rabbit
Human C4BPA human
(Sigma-Aldrich Cat# HPA000926, RRID:AB_1078355)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA000926
Anti-C4BPA antibody produced in rabbit
C4BPA antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000926, RRID:AB_1078355)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA000926
Anti-C4BPA antibody
C4BPA epitope: CDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQST See NCBI gene human
(Atlas Antibodies Cat# HPA000926, RRID:AB_1078355)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA000926