Showing 1 - 3 results out of 3 with the query:
AB_1078426
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CCT3 antibody produced in rabbit
CCT3 human
(Sigma-Aldrich Cat# HPA006543, RRID:AB_1078426)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006543
Anti-CCT3 antibody produced in rabbit
CCT3 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA006543, RRID:AB_1078426)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA006543
Anti-CCT3 polyclonal antibody Go To Vendor
CCT3 epitope: SLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPK See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA006543, RRID:AB_1078426)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006543