Showing 1 - 3 results out of 3 with the query:
AB_1078483
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CD79B antibody produced in rabbit
CD79B human
(Sigma-Aldrich Cat# HPA009178, RRID:AB_1078483)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA009178
Anti-CD79B antibody produced in rabbit
CD79B antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA009178, RRID:AB_1078483)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA009178
Anti-CD79B antibody Go To Vendor
CD79B epitope: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE See NCBI gene human
(Atlas Antibodies Cat# HPA009178, RRID:AB_1078483)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA009178