Showing 1 - 3 results out of 3 with the query:
AB_1078533
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CLEC2B antibody produced in rabbit
Human CLEC2B human
(Sigma-Aldrich Cat# HPA008194, RRID:AB_1078533)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA008194
Anti-CLEC2B polyclonal antibody Go To Vendor
CLEC2B epitope: LCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKR See NCBI gene human
(Atlas Antibodies Cat# HPA008194, RRID:AB_1078533)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008194
Anti-CLEC2B antibody produced in rabbit
CLEC2B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008194, RRID:AB_1078533)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA008194