Showing 1 - 3 results out of 3 with the query:
AB_1078545
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CNTNAP2 antibody produced in rabbit
Human CNTNAP2 human
(Sigma-Aldrich Cat# HPA002739, RRID:AB_1078545)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002739
Anti-CNTNAP2 antibody produced in rabbit
CNTNAP2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002739, RRID:AB_1078545)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA002739
Anti-CNTNAP2 antibody
CNTNAP2 epitope: CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSS See NCBI gene human
(Atlas Antibodies Cat# HPA002739, RRID:AB_1078545)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA002739