Showing 1 - 3 results out of 3 with the query:
AB_1078563
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CPT1A antibody produced in rabbit
Human CPT1A human
(Sigma-Aldrich Cat# HPA008835, RRID:AB_1078563)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA008835
Anti-CPT1A polyclonal antibody Go To Vendor
CPT1A epitope: ARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYA See NCBI gene human
(Atlas Antibodies Cat# HPA008835, RRID:AB_1078563)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYA; Manufacturer approved use: ICC-IF, IHC, WB
rabbit
Atlas Antibodies
HPA008835
Anti-CPT1A antibody produced in rabbit
CPT1A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008835, RRID:AB_1078563)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA008835