Showing 1 - 3 results out of 3 with the query:
AB_1078591
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CXorf21 antibody produced in rabbit
Human CXorf21 human
(Sigma-Aldrich Cat# HPA001185, RRID:AB_1078591)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA001185
Anti-CXorf21 antibody produced in rabbit
CXorf21 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001185, RRID:AB_1078591)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA001185
Anti-CXorf21 polyclonal antibody Go To Vendor
CXorf21 epitope: EIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQILASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMST See NCBI gene human
(Atlas Antibodies Cat# HPA001185, RRID:AB_1078591)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA001185