Showing 1 - 3 results out of 3 with the query:
AB_1078701
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TNFRSF21 antibody produced in rabbit
Human TNFRSF21 human
(Sigma-Aldrich Cat# HPA006746, RRID:AB_1078701)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006746
Anti-TNFRSF21 antibody produced in rabbit
TNFRSF21 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006746, RRID:AB_1078701)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA006746
Anti-TNFRSF21 polyclonal antibody Go To Vendor
TNFRSF21 epitope: PVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTS See NCBI gene human
(Atlas Antibodies Cat# HPA006746, RRID:AB_1078701)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006746