Showing 1 - 3 results out of 3 with the query:
AB_1078787
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-F5 antibody produced in rabbit
Human F5 human
(Sigma-Aldrich Cat# HPA002036, RRID:AB_1078787)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002036
Anti-F5 antibody produced in rabbit
F5 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002036, RRID:AB_1078787)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA002036
Anti-F5 polyclonal antibody
F5 epitope: MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT See NCBI gene human
(Atlas Antibodies Cat# HPA002036, RRID:AB_1078787)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA002036