Showing 1 - 3 results out of 3 with the query:
AB_1078902
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FOXJ1 antibody produced in rabbit
Forkhead box protein J1 recombinant protein epitope signature tag human
(Sigma-Aldrich Cat# HPA005714, RRID:AB_1078902)
polyclonal antibody
Used By NYUIHC-728
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
rabbit
Sigma-Aldrich
HPA005714
Anti-FOXJ1 polyclonal antibody Go To Vendor
FOXJ1 epitope: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG See NCBI gene human
(Atlas Antibodies Cat# HPA005714, RRID:AB_1078902)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
rabbit
Atlas Antibodies
HPA005714
Anti-FOXJ1 antibody produced in rabbit
FOXJ1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA005714, RRID:AB_1078902)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA005714