Showing 1 - 3 results out of 3 with the query:
AB_1079011
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GOLGB1 antibody produced in rabbit
Human GOLGB1 human
(Sigma-Aldrich Cat# HPA011008, RRID:AB_1079011)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA011008
Anti-GOLGB1 antibody produced in rabbit
GOLGB1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA011008, RRID:AB_1079011)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA011008
Anti-GOLGB1 antibody Go To Vendor
GOLGB1 epitope: KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS See NCBI gene human
(Atlas Antibodies Cat# HPA011008, RRID:AB_1079011)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA011008