Showing 1 - 3 results out of 3 with the query:
AB_1079051
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GCK antibody produced in rabbit
Human GCK human
(Sigma-Aldrich Cat# HPA007093, RRID:AB_1079051)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA007093
Anti-GCK antibody produced in rabbit
GCK antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA007093, RRID:AB_1079051)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA007093
Anti-GCK polyclonal antibody Go To Vendor
GCK epitope: DLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIK See NCBI gene human
(Atlas Antibodies Cat# HPA007093, RRID:AB_1079051)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIK; Manufacturer approved use: ICC-IF, IHC
rabbit
Atlas Antibodies
HPA007093