Showing 1 - 3 results out of 3 with the query:
AB_1079135
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-IL23A antibody produced in rabbit
Human IL23A human
(Sigma-Aldrich Cat# HPA001554, RRID:AB_1079135)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA001554
Anti-IL23A antibody produced in rabbit
IL23A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001554, RRID:AB_1079135)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA001554
Anti-IL23A polyclonal antibody
IL23A epitope: SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF See NCBI gene human
(Atlas Antibodies Cat# HPA001554, RRID:AB_1079135)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies Go To Vendor
HPA001554