Showing 1 - 3 results out of 3 with the query:
AB_1079148
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-IRF4 antibody produced in rabbit
Human IRF4 human
(Sigma-Aldrich Cat# HPA002038, RRID:AB_1079148)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002038
Anti-IRF4 antibody produced in rabbit
IRF4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002038, RRID:AB_1079148)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA002038
Anti-IRF4 antibody Go To Vendor
IRF4 epitope: SNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPE See NCBI gene human
(Atlas Antibodies Cat# HPA002038, RRID:AB_1079148)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA002038