Showing 1 - 3 results out of 3 with the query:
AB_1079182
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-KRT9 antibody produced in rabbit
Human KRT9 human
(Sigma-Aldrich Cat# HPA007261, RRID:AB_1079182)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA007261
Anti-KRT9 antibody produced in rabbit
KRT9 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA007261, RRID:AB_1079182)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Western Blot; Other; Immunofluorescence; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA007261
Anti-KRT9 polyclonal antibody Go To Vendor
KRT9 epitope: KEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLE See NCBI gene human
(Atlas Antibodies Cat# HPA007261, RRID:AB_1079182)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA007261