Showing 1 - 3 results out of 3 with the query:
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Host Organism
Cat Num
Anti-KIF1A antibody produced in rabbit
Human KIF1A human
(Sigma-Aldrich Cat# HPA005442, RRID:AB_1079210)
Vendor recommendations:
Anti-KIF1A antibody produced in rabbit
KIF1A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA005442, RRID:AB_1079210)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Anti-KIF1A polyclonal antibody
KIF1A See NCBI gene human
(Atlas Antibodies Cat# HPA005442, RRID:AB_1079210)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIF; Manufacturer approved use: IHC
Atlas Antibodies Go To Vendor