Showing 1 - 3 results out of 3 with the query:
AB_1079266
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-XPNPEP3 antibody produced in rabbit
Human XPNPEP3 human
(Sigma-Aldrich Cat# HPA000527, RRID:AB_1079266)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA000527
Anti-XPNPEP3 antibody produced in rabbit
XPNPEP3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000527, RRID:AB_1079266)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
rabbit
Sigma-Aldrich
HPA000527
Anti-XPNPEP3 polyclonal antibody
XPNPEP3 epitope: THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ See NCBI gene human, rat
(Atlas Antibodies Cat# HPA000527, RRID:AB_1079266)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA000527