Showing 1 - 3 results out of 3 with the query:
AB_1079293
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
MAFB-human antibody Go To Vendor
MAFB homo sapiens
(Sigma-Aldrich Cat# HPA005653, RRID:AB_1079293)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot A31532 for MCF-7,HeLa-S3,GM12878,K562,liver,HepG2; status is not eligible for new data,awaiting lab characterization
rabbit
Sigma-Aldrich
HPA005653
Anti-MAFB antibody produced in rabbit
MAFB antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA005653, RRID:AB_1079293)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA005653
Anti-MAFB polyclonal antibody Go To Vendor
MAFB epitope: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH See NCBI gene human
(Atlas Antibodies Cat# HPA005653, RRID:AB_1079293)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA005653