Showing 1 - 3 results out of 3 with the query:
AB_1079359
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-MAP3K7 antibody produced in rabbit
Human MAP3K7 human
(Sigma-Aldrich Cat# HPA007633, RRID:AB_1079359)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA007633
Anti-MAP3K7 antibody produced in rabbit
MAP3K7 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA007633, RRID:AB_1079359)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA007633
Anti-MAP3K7 polyclonal antibody Go To Vendor
MAP3K7 epitope: NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS See NCBI gene human
(Atlas Antibodies Cat# HPA007633, RRID:AB_1079359)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA007633