Showing 1 - 2 results out of 2 with the query:
AB_10793989
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TNIP3 antibody produced in rabbit
TNIP3 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA043063, RRID:AB_10793989)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA043063
Anti-TNIP3 antibody Go To Vendor
TNIP3 epitope: NKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLNR See NCBI gene human
(Atlas Antibodies Cat# HPA043063, RRID:AB_10793989)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA043063