Showing 1 - 3 results out of 3 with the query:
AB_1079483
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-NGDN antibody produced in rabbit
Human NGDN human
(Sigma-Aldrich Cat# HPA000944, RRID:AB_1079483)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA000944
Anti-NGDN antibody produced in rabbit
NGDN antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000944, RRID:AB_1079483)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA000944
Anti-NGDN polyclonal antibody
NGDN epitope: LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL See NCBI gene human
(Atlas Antibodies Cat# HPA000944, RRID:AB_1079483)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA000944