Showing 1 - 2 results out of 2 with the query:
AB_10794922
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ABCC12 antibody produced in rabbit
ABCC12 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA043100, RRID:AB_10794922)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA043100
Anti-ABCC12 polyclonal antibody Go To Vendor
ABCC12 epitope: GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV See NCBI gene human
(Atlas Antibodies Cat# HPA043100, RRID:AB_10794922)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA043100