Showing 1 - 2 results out of 2 with the query:
AB_10795270
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-BTBD9 antibody produced in rabbit
BTBD9 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA041930, RRID:AB_10795270)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA041930
Anti-BTBD9 polyclonal antibody
BTBD9 epitope: ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR See NCBI gene human
(Atlas Antibodies Cat# HPA041930, RRID:AB_10795270)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA041930