Showing 1 - 3 results out of 3 with the query:
AB_1079532
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-SPARC antibody produced in rabbit
Human SPARC human
(Sigma-Aldrich Cat# HPA002989, RRID:AB_1079532)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002989
Anti-SPARC antibody produced in rabbit
SPARC antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002989, RRID:AB_1079532)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot
rabbit
Sigma-Aldrich
HPA002989
Anti-SPARC antibody
SPARC epitope: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL See NCBI gene human
(Atlas Antibodies Cat# HPA002989, RRID:AB_1079532)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA002989