Showing 1 - 3 results out of 3 with the query:
AB_1079543
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-P2RY8 antibody produced in rabbit
Human P2RY8 human
(Sigma-Aldrich Cat# HPA003631, RRID:AB_1079543)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA003631
Anti-P2RY8 antibody produced in rabbit
P2RY8 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003631, RRID:AB_1079543)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA003631
Anti-P2RY8 polyclonal antibody Go To Vendor
P2RY8 epitope: GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF See NCBI gene human
(Atlas Antibodies Cat# HPA003631, RRID:AB_1079543)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA003631