Showing 1 - 3 results out of 3 with the query:
AB_1079587
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PDE4B antibody produced in rabbit
Human PDE4B human
(Sigma-Aldrich Cat# HPA003005, RRID:AB_1079587)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA003005
Anti-PDE4B antibody produced in rabbit
PDE4B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003005, RRID:AB_1079587)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA003005
Anti-PDE4B polyclonal antibody
PDE4B epitope: SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT See NCBI gene human
(Atlas Antibodies Cat# HPA003005, RRID:AB_1079587)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA003005