Showing 1 - 2 results out of 2 with the query:
AB_10795889
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PTGES antibody produced in rabbit
PTGES antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA045064, RRID:AB_10795889)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA045064
Anti-PTGES polyclonal antibody Go To Vendor
PTGES epitope: ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM See NCBI gene human, mouse
(Atlas Antibodies Cat# HPA045064, RRID:AB_10795889)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA045064