Showing 1 - 3 results out of 3 with the query:
AB_1079614
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PI4KB antibody produced in rabbit
Human PIK4CB human
(Sigma-Aldrich Cat# HPA006281, RRID:AB_1079614)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006281
Anti-PI4KB antibody produced in rabbit
PI4KB antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006281, RRID:AB_1079614)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA006281
Anti-PI4KB polyclonal antibody Go To Vendor
PI4KB epitope: TPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY See NCBI gene human
(Atlas Antibodies Cat# HPA006281, RRID:AB_1079614)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006281