Showing 1 - 2 results out of 2 with the query:
AB_10796216
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ABHD14A antibody produced in rabbit
ABHD14A antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038154, RRID:AB_10796216)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA038154
Anti-ABHD14A polyclonal antibody Go To Vendor
ABHD14A epitope: PGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ See NCBI gene human
(Atlas Antibodies Cat# HPA038154, RRID:AB_10796216)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies
HPA038154