Showing 1 - 2 results out of 2 with the query:
AB_10796680
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SLC26A4 antibody produced in rabbit
SLC26A4 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA042860, RRID:AB_10796680)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA042860
Anti-SLC26A4 polyclonal antibody
SLC26A4 epitope: FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK See NCBI gene human
(Atlas Antibodies Cat# HPA042860, RRID:AB_10796680)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA042860