Showing 1 - 3 results out of 3 with the query:
AB_1079681
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
PGR-human antibody Go To Vendor
PGR homo sapiens
(Sigma-Aldrich Cat# HPA004751, RRID:AB_1079681)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R04125 for any cell type or tissues; status is awaiting lab characterization
rabbit
Sigma-Aldrich
HPA004751
Anti-PGR antibody produced in rabbit
PGR antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004751, RRID:AB_1079681)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA004751
Anti-PGR antibody Go To Vendor
PGR epitope: RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS See NCBI gene human
(Atlas Antibodies Cat# HPA004751, RRID:AB_1079681)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004751