Showing 1 - 3 results out of 3 with the query:
AB_1079746
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RBM22 antibody produced in rabbit
Human RBM22 human
(Sigma-Aldrich Cat# HPA001634, RRID:AB_1079746)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA001634
Anti-RBM22 antibody produced in rabbit
RBM22 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001634, RRID:AB_1079746)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA001634
Anti-RBM22 polyclonal antibody
RBM22 epitope: NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA001634, RRID:AB_1079746)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA001634